DPCstruct | MC17429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 349 |
|---|---|
| Mean domain length (aa) | 198 ± 56 aa |
| Standard deviation of domain lengths | 56.37 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.03 |
| Pfam Score | 76.00 |
| Assigned Pfam label(s) | PF01548- PF09785- CL0040- CL0198- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178GUG1 | 52-245 | APPEVRRLRDFYRCLQALKDDKLQQMNRLENKNMYSSCKQAILEVVTTIDTQTAAIEKEINEHINNYPHLKNMIENLKTVKGVGHLT… |
| A0A271L0U2 | 5-259 | LCASIRYHHRQRVYAMEQRKRADLALGSFLRMMLGWSLALPKEDQDAIRARSAELLKSGGEGTEWAHIIEASVQSRKPFDDIEAAAL… |
| A0A2H5ZYE0 | 64-247 | None |
| W6K1I1 | 21-157 | None |
| A0A542IVP8 | 37-273 | None |
| G9PRF3 | 1-259 | None |
| A0A496PZY6 | 2-149 | None |
| A0A7C5Q3A9 | 30-306 | None |
| A0A377YU75 | 2-105 | None |
| A0A7C2L3J5 | 44-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.