DPCstruct | MC17426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 219 ± 34 aa |
| Standard deviation of domain lengths | 33.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF11938- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VUA8 | 53-289 | TKLPPCAACRVLTESFNKGIESTARGKYEGGDSAWEEEKKLSYKKSEVRLIEIQEKLCKDVERGQKQCESNAEEHEGLLEDWWFREQ… |
| A0A820JDR8 | 3-228 | GNFMNVDPCITCKAISEKFVEGYKKTAGSNFGGGNTDWEEKKLKAYAKSETRFIEIMEDACPKSESQCNGFLEKYEDQIEEWYQSSS… |
| F7C568 | 29-265 | None |
| A0A7J8HNR4 | 32-213 | None |
| K7HMP9 | 193-428 | None |
| A0A6P4YUU0 | 5-252 | None |
| A0A3L8DUU8 | 164-356 | None |
| A0A5F8AAL3 | 22-234 | None |
| A0A6P6CYQ0 | 70-305 | None |
| A0A6J0HRD9 | 719-903 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.