DPCstruct | MC17425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9ZNW4 | 106-258 | NRLRFKRGMDPLGAGVKGDVLLEGALVQVRVCLVGRGAPDDLAVVYAVGDEEALQWKNAAAQRKKTGNGMAVDNPPDETELSSIVPP… |
| A0A4V3X9T3 | 2-152 | NKLREKRKMGPLTVRADKLWQSAIVRVSARMCGRGRPEDLAVIYQMDDEEARKWMKAESNRKNGLAAMHENTEDETELSTVAPAQES… |
| A0A1J8QFP9 | 308-453 | None |
| A0A5N5QQP4 | 642-780 | None |
| A0A177TQU9 | 1075-1242 | None |
| A0A3F2RXZ2 | 943-1093 | None |
| K3WLE1 | 737-851 | None |
| A0A183BBE9 | 4-127 | None |
| A0A5N6KPI2 | 482-664 | None |
| L1JDB3 | 601-751 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.