DPCstruct | MC17422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 584 ± 76 aa |
| Standard deviation of domain lengths | 75.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084G9L5 | 171-706 | GVHTDIPLVLREVYSSGTKMATTVSNFFDIEWRQLTMRTQEVLNNGTEYPVGIFRQLDSILLWDSYKAVEGLVVNGKEGGIGFRNHT… |
| A0A0D2B178 | 22-657 | VTIPANFTKMFTSATSGLGDTRSGMFDIQYRRWKFDQNAIINKGKPYVNASSRNISSMISQNSILLVEGVVVDTRKNPGIGFRNHTI… |
| A0A015K4W7 | 158-582 | None |
| A0A6A6ZE52 | 145-798 | None |
| A0A401L5X3 | 484-1116 | None |
| A0A0J9W128 | 1-509 | None |
| A0A397UC91 | 174-668 | None |
| A0A0S7DZR8 | 383-984 | None |
| A0A2C5Z693 | 177-838 | None |
| A0A1S9DJT4 | 510-1129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.