DPCstruct | MC17420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19450 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T3P570 | 68-137 | HPDNELRVALTGGFPEMPSMLVVAGPDIPDKVSIEFRNGREHYEYTGGVLDLDGASLPLFRWSYSTRIAE |
| A0A5D0NLM4 | 10-86 | GARAAEPGTVEAALVGGPADIPESTRRCRADAGARTIKLAHRGGYEHFELVDAADPADPAADGPAIFRWTTRTKIAE |
| A0A1C6UZ23 | 3-75 | None |
| A0A6A0B2J5 | 95-166 | None |
| A0A640TH55 | 44-116 | None |
| A0A229SUE7 | 2-67 | None |
| A0A4R2AMS5 | 1-65 | None |
| A0A0B5EQD3 | 192-262 | None |
| A0A318KE15 | 19-103 | None |
| A0A2G6XLB7 | 54-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.