DPCstruct | MC1742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 142 ± 32 aa |
| Standard deviation of domain lengths | 32.30 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12646 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087S9J1 | 2-131 | LAVGFSPRELEELRALLVELDAHMVELIVATDRMLDMPLSQALKTREGPSERKRPGRPIVYEDGSGSPRTLVLLGMHASEVMEITGA… |
| A0A831NNY9 | 1-117 | MILLIGFRDDEVERIEEVLGEEVFSVGEGGLNREVSEVLSSPRDYHGYADVGGKFLIMHEIPGERVGEIVKGVKGVVGEVIPATTTP… |
| A0A3R6PDD4 | 2-103 | None |
| A4RT50 | 82-212 | None |
| W8P4A2 | 2-115 | None |
| A0A1I5BWK6 | 2-114 | None |
| A0A4S4DHG1 | 7-120 | None |
| A0A4Y7KXV5 | 178-272 | None |
| A0A7R9XR85 | 17-166 | None |
| I0Z0K6 | 78-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.