DPCstruct | MC17415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 105 ± 18 aa |
| Standard deviation of domain lengths | 18.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0HKC4 | 99-201 | AQICAIANEYENLISAEFVPPHEALEIIMARSGIRYSQQIVRLFVETIPAYLPGTMVKMGDGRNAIVTKIVEHMQRPYVRYTDTREE… |
| A0PXJ3 | 13-112 | DFSGYTKMEVYKALEYLIAMSQTIFDKKLVDAFVKNIAAYPSGTIVKLNTGDSAIVLKQNASLPLRPVVNIIFDKNNCKLDNPITLD… |
| A0A257VPN5 | 74-186 | None |
| A0A395V7F3 | 10-74 | None |
| A0A645JLS9 | 1-76 | None |
| A0A7X8IXA3 | 33-131 | None |
| A0A1V2YM01 | 157-261 | None |
| A0A1F9M6R7 | 355-461 | None |
| A0A831SM24 | 2-66 | None |
| A0A1Q8YGS1 | 68-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.