DPCstruct | MC17412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 514 ± 59 aa |
| Standard deviation of domain lengths | 59.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409YFB6 | 12-443 | PNISYNPYLHSSYQRNSPFEQIPVYDSVVPPPGYRPRPHPQYYGGPSPQEEALRQARARALAEKQARRAQYLPDEEDSVGSDDEWEY… |
| A0A4V6S1V8 | 1-517 | MFRYGIPVYDQGYARAVAEEQAAHAQYAAALRAQEEARNRAARARAARQAYTSPYASFLPTDHADEDEGEEEYPAYGSPDAYGSAYG… |
| A0A1C7MDC6 | 342-906 | None |
| E3KUS8 | 1-549 | None |
| A0A164Q613 | 1-513 | None |
| A0A2R6NYA6 | 46-616 | None |
| A0A0L6VJM7 | 4-448 | None |
| A0A511KAN2 | 3-417 | None |
| A0A0L0VFB6 | 82-623 | None |
| A0A5C3P6A4 | 35-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.