DPCstruct | MC17408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10977 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M6WZW4 | 1-156 | MAENDLCILRPDTCHFHLGTCREPDWGETHCFISHTVYLANSSAIKVGITKENPVSNRWVDQGAVQGIPLVEVISRRDAGIIEKELS… |
| A0A2R6LCY0 | 2-111 | DCYQEHAVYLAAFAPATFKVGVTRLERLDARWREQGADRAAHLHSVSNGRLAREIEAEIAADVGDSVRVPTKVEGLARPVDDDAWRS… |
| A0A2I0N7K5 | 64-205 | None |
| A0A455UDL8 | 1-146 | None |
| A0A7J6Z641 | 92-217 | None |
| A0A847US97 | 98-214 | None |
| A0A3D1FYR2 | 153-295 | None |
| A0A812NHE2 | 87-239 | None |
| A0A1D9MLY9 | 89-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.