DPCstruct | MC17407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0023- PF08766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3DZW2 | 255-363 | AASGAASRPAAADADADSDSDFEVEVVGEKGQVTTRDFPHPRPDCAVHKFKDNGVASNAQHCANCFCYVCDVKASECAYWGTGEQHT… |
| F4JYU9 | 3-115 | KKEEDDTPLVGIFCLKTRQDMKRFEETEDCFILDFDPFDSFDVKKLTFTDDVREDYPHPRHFCLNFPFGSTPNSSHCDLCYCYVCDK… |
| R1CQH7 | 125-233 | None |
| R1C1P8 | 2-90 | None |
| A0A482ULU7 | 7-152 | None |
| R1BVQ6 | 313-445 | None |
| A0A1U7Y1V0 | 59-181 | None |
| A0A6I8NUP7 | 63-205 | None |
| A0A446IXP1 | 1-75 | None |
| A0A6G1F1F1 | 42-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.