DPCstruct | MC17405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A200R023 | 4-79 | FAKPENALKRAEELINVGQKQAALQALHDLITSRRYRAWQKTLERIMFKYVELCVDMRRGRFAKDGLIQYRIVCEQ |
| U6ME63 | 4-82 | FQKPENALKRANELLSIGQQEAALKILHAAIGHKRFRSQGWDAVQEAIMLRHVQLCVDEGKLRLAKDGLHQYRIVSQHA |
| A0A6A3ANZ1 | 4-79 | None |
| A0A7J7JGM5 | 2-79 | None |
| A0A426YKF9 | 7-69 | None |
| A0A811PJE1 | 4-79 | None |
| R1D222 | 4-80 | None |
| A0A2B4S8Q9 | 2-81 | None |
| A0A553QMK2 | 3-65 | None |
| A0A3M7L466 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.