DPCstruct | MC17402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2V4M8 | 11-165 | ATTMMHHHVDAWDHDVFKTVVSHLGSSDLVYNSISFYIQTNPQLLDDFLTSMFKTLDPERVLLEVKKLAPVHFIRQYLESAQERNSR… |
| A0A251T805 | 27-159 | NVELYYKVVHFYLQEHPDLINDVLNVLALCVDHTRVVDIMRKAGQLPLAKPYIVAVQSNNVFAVNEALNEIYVEDEDYDRLNESIDV… |
| A0A7J0E7A0 | 471-600 | None |
| A0A815UFD4 | 1-134 | None |
| A0A2N9IVW0 | 22-162 | None |
| A0A2S4UMU0 | 22-156 | None |
| Q10161 | 1372-1527 | None |
| A0A0P0XY45 | 405-541 | None |
| A0A397U7A6 | 281-434 | None |
| A0A821A401 | 175-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.