DPCstruct | MC1740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 262 ± 51 aa |
| Standard deviation of domain lengths | 50.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0BNS0 | 17-273 | TTKTGSYKIQALDRALEIPSVHYLWDKSAQIYSRVKGANTVVHRALDTVEHVVCLVVEKTCTPVVRLMEKPIFNLDQTLCQGIDFVQ… |
| A0A482WBD3 | 1-225 | MAETQVNPSANAPTCMESVNRIAKLPVVESSIQTASNIYEKIKDYNGVTQWTCSTAENVVNKAVEVGKPIAVPIVQGLEGPIKKVDD… |
| A0A1X2HFJ5 | 14-367 | None |
| A0A224XNT9 | 9-255 | None |
| A0A6P8MUR9 | 26-243 | None |
| A0A6H5HB84 | 283-492 | None |
| F4WXU0 | 77-322 | None |
| A0A195D506 | 1-319 | None |
| A0A653C8J8 | 3-322 | None |
| A0A2R7VZD0 | 179-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.