DPCstruct | MC174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 71.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10241 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517LR70 | 1-173 | MPQKPGTYPTYPHHVPYSRVSVSPPEAPESITTGSGLTSYDPSAASSSYAGSASEYDPSSSGAASIDLLDYMNDRLTGSYNPMPLDR… |
| A0A6A6EZH1 | 1-183 | MSTSYYQYPTGTLPVNVPGKAQQNARHARNPSAYSQLSASPPERPESVSSTGAGLYSSASSAYGGSDYDSSSGATSVDLLDYMNDRL… |
| R8BWC3 | 5-185 | None |
| A0A4Z0X0K8 | 1-190 | None |
| A0A5N6EKN0 | 2-181 | None |
| S3C1Z6 | 90-279 | None |
| A0A0F4ZK37 | 1-181 | None |
| A0A6J3M0S9 | 1-191 | None |
| A0A4U7AYK7 | 1-185 | None |
| A0A447CG61 | 4-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.