DPCstruct | MC17399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 133 ± 20 aa |
| Standard deviation of domain lengths | 19.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04386 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5LV91 | 37-139 | TSPDLKSETGSQFQTMFKEIMKKRELPYVEIAVNEFGVAVPTSHIDGPTMTLDLSFKAVDGLHWEGDRLLFRAKFSGSSEKVCLPVK… |
| A0A0S8FG76 | 1-106 | MHEWISDNGQTAHIVVDATVDGVEVPAEHVKEGKIILNISHGATSNLAIGNEIVEFGARFGGAPRQLTIPVSAVLGIYARETGQGMI… |
| A0A538QXV0 | 166-300 | None |
| A0A2X0VNV1 | 17-165 | None |
| A0A3M2DJG2 | 117-251 | None |
| A0A6P5WBQ1 | 8-174 | None |
| A0A844HS01 | 56-169 | None |
| A0A432WK20 | 6-128 | None |
| A7I2C2 | 1-134 | None |
| A0A2D5QNL8 | 13-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.