DPCstruct | MC17398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T9ZL39 | 34-116 | HLCSTVDSITRYIKCLSELIKSPEGKPIPKARAIGATLASASGVHADKIVSHAFWSSYSIFDSYYQLSRCFDDNLTESILALN |
| A0A1R1YF26 | 9-87 | KPLSVYSITRYIHSISGLIRRDPNTPIPKGRAIGATLAANAGVTSDDIVSHAFWSNYTIFDTFYRLARNSSNDLTESIL |
| A0A197JB15 | 1-65 | None |
| A0A2T9YTK4 | 78-157 | None |
| A0A2T9YTR4 | 717-798 | None |
| A0A2T9YZF0 | 356-434 | None |
| A0A2G4SLI1 | 187-265 | None |
| A0A162V8M0 | 53-119 | None |
| A0A1R1XJT9 | 2-69 | None |
| A0A1R1XJ70 | 5-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.