DPCstruct | MC17396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 260 |
|---|---|
| Mean domain length (aa) | 186 ± 37 aa |
| Standard deviation of domain lengths | 36.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 99.13 |
| Assigned Pfam label(s) | CL0028- CL0281- CL0625- CL0296 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7REQ6 | 2-170 | KHPLQNRWVLWFFKNDKSKSWAANLRNITSFDTVEDFWGIYNHIQQASRLQPGCDYSLFKDGIEPMWEDKRNKDGGRWLINTNKNQR… |
| A0A2T9ZAW9 | 59-250 | KDQAEPLSKEQSTSATVNQIDAPTTPNSHPLQYSWTFWYMHREPGQKIVDYEASTIKIGSFFTVEEFWNVYTHTIRPNDMPIILDLH… |
| A0A1D2MY59 | 44-240 | None |
| G8BJS0 | 144-333 | None |
| A0A0W0W1M1 | 23-171 | None |
| A0A2E0L224 | 2-134 | None |
| A0A0D2MUE9 | 116-407 | None |
| A0A1C7NJM3 | 140-331 | None |
| A0A812QH07 | 317-556 | None |
| A0A812QFU9 | 33-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.