DPCstruct | MC17394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 14.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 22.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3XEK2 | 5-113 | AAEKVKGMMQSLQAILKITQQEGKDLGGRKIMQVDVEAAKISAAAESLLRIVESLKETALLEDAKEANRNVQRIENKLRTMETRVDE… |
| A0A2T9YSX3 | 8-145 | TIESAEPSLHWSFKQNQLHKGEAEFNSKIASEIENMVSSMKTIIELCQIKEKNKFQVFQEGYQIHSKVATLVKCAETLLSIISNLKK… |
| A0A667I4L4 | 130-267 | None |
| A0A074RYN3 | 23-170 | None |
| A0A2T2P924 | 1-123 | None |
| A0A1Q5UEI9 | 95-204 | None |
| S9VVM5 | 1-134 | None |
| D3AXG1 | 33-164 | None |
| A0A811LQB3 | 300-437 | None |
| A0A1Y1W1G5 | 28-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.