DPCstruct | MC17391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831YFF3 | 1-105 | MADIVMYLDLMSSKGGSVVAKCFTTDLGKAFAVAERLELSGLRPNIVKSNSENVVYIPMSDLLKLAEQDDEIRRAIALYLAEKAKNG… |
| F0QUS6 | 3-134 | EDWGKLLDAEKLRQLLALVNMNVKPLDRSLVDEVDVKLIVYVDNSGYVKLRTVRMDYGGAMSILERLKRTSYNGAELTKWSGRCMAY… |
| A0A6B2CSM1 | 49-151 | None |
| A0A101X9M6 | 6-115 | None |
| E1QSM4 | 467-574 | None |
| A0A2J2HBV2 | 4-115 | None |
| G7VGX5 | 218-334 | None |
| A0A101X9Q9 | 303-423 | None |
| A0A831YGK4 | 6-123 | None |
| A0A7C5T8S6 | 7-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.