DPCstruct | MC17390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 12 aa |
| Standard deviation of domain lengths | 12.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9B968 | 22-205 | DMLHREARALAIQRIEESARTEADFENVLYWWDKLDANRERKERDHETGRSTVPPEWGAYELYLSDSPSYDMILRRLMLAGNFLDII… |
| A0A1I0K9Z0 | 2-165 | IAWWDRLDADRERRERYHELSRSGDDVPLDYGASANELFFPDMLNDVLEKQLRKGDFIDAIFYCPYDIHELVTEEYLSKILWELNEE… |
| A0A810PZK2 | 3-176 | None |
| A0A351V715 | 47-248 | None |
| A0A1Q6L1Z6 | 93-275 | None |
| A0A7X6VJ06 | 9-193 | None |
| A0A349DAK4 | 42-228 | None |
| A0A7X4IAE8 | 44-227 | None |
| A0A3R6WP16 | 2-162 | None |
| A0A374JVG8 | 66-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.