DPCstruct | MC1739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 354 ± 35 aa |
| Standard deviation of domain lengths | 35.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 26.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183AQ72 | 1-280 | MESVNEELILTGSEAVAVTAVILDAVTELKTLINLIDIRKTQIPNQRGVQPQSNNSAAIESDHLESTIEDLFNSKTYTEKLKTDMIQ… |
| A0A6J0B829 | 169-551 | TIGNKGSSSDANVKSLTMDHQTAITLSSLEAASFYCVLQECLDFLSILRYVIPAEIDERWDERYKTIAELYGVPDEPKMIFREDMGL… |
| F4WGY1 | 1-327 | None |
| A0A834N5H0 | 181-537 | None |
| A0A2T7NCL3 | 287-697 | None |
| A0A669QBZ3 | 6-377 | None |
| A0A0A9VQB7 | 150-482 | None |
| A0A556V8I9 | 2-362 | None |
| A0A158NVN1 | 30-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.