DPCstruct | MC17382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 3.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327RU28 | 3-63 | FVNADSIAHGLSPFNPESVALESGRIMLQRIRELMMTRVDFAFETTLSARSYVSLVKQAQQ |
| A0A2V7H4W9 | 3-62 | EFVNADAIGQGLSAFNAQSAAVTAGRLMLKRLKQLADRNVSFAFETTLASRTFAPWLKEK |
| A0A3B9LUH9 | 127-186 | None |
| A0A522F1J3 | 26-95 | None |
| A0A2E9QBI1 | 11-71 | None |
| A0A1G1K2J4 | 139-202 | None |
| A0A810DTK5 | 7-67 | None |
| A0A6N6Z4Y9 | 3-70 | None |
| A0A2H2X6I8 | 30-91 | None |
| A0A7W1FKW3 | 31-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.