DPCstruct | MC17380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 109 ± 21 aa |
| Standard deviation of domain lengths | 20.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 79.61 |
| Assigned Pfam label(s) | PF14934- PF10615- CL0336- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1KL19 | 17-101 | LPFGDDVVEAVLRHMRDDHASDGVVIVRRHGAPGATAALMLGFDALETTWSVTDADGTEGVLTVPWPAPITDRASVRRQVVELFD |
| A0A2V7F4X6 | 27-121 | WVSAPDYFAAEPDPLVDAAAGVMEHMNRDHADALVAYARFYAGEEANEATMVAVDRLGFKLRLRQGDRLHSVRIAFPREVRTAGESR… |
| A0A0K2XUG3 | 3-98 | None |
| A0A2G3D1E0 | 331-450 | None |
| U2SNY4 | 19-106 | None |
| A0A7H1N2F9 | 95-238 | None |
| A0A819TG20 | 7-115 | None |
| A0A5N6P306 | 1089-1227 | None |
| R1BTZ2 | 3-88 | None |
| A0A2A2KJW5 | 45-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.