DPCstruct | MC1738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZR83 | 26-184 | KETEGLSEEEIEPVDTTPKFVSIFEILDAPRNLPQSVPLTIDHVKQIQSELGLITLCWPDIEDPSFENRVTFPESYIKNSNKEKLLL… |
| A0A6J0B3N9 | 37-205 | LKKSTRRSTFAVPGILAIDGDHEYDEDESEGDGENKTRQESEYAVPFEISAAILKQIQQELCLIQLSWPEIKYIDIEEKFLPSSYNN… |
| A0A3Q0JCH5 | 8-189 | None |
| A0A7S4U8L7 | 19-230 | None |
| A0A226ETJ1 | 43-261 | None |
| A0A1I8N926 | 21-176 | None |
| A0A182J2K5 | 27-195 | None |
| A0A819SAL4 | 6-145 | None |
| A0A834DBZ3 | 1-178 | None |
| A0A834J2X5 | 7-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.