DPCstruct | MC17378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 111 ± 24 aa |
| Standard deviation of domain lengths | 23.84 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7F3P7 | 6-112 | TRSGMQILYELSAFVSVPEEHVRGGRAFPPPPQAADTENAFPPTVRVLSGSWRPDAAFAAVRYGDHWYWIDDGDLRSKGVFTFLLIL… |
| A0A286U4K2 | 206-315 | RSIISVLFYLSQNIDIPEEHKKAGLITVTKTQGGEEFNWGETPGGMLFKVRFSKQKPRNAFISVPYRGAWFYIADNDLCSKSTFLLL… |
| A0A0J7KH79 | 328-449 | None |
| A0A059V131 | 1-73 | None |
| A0A177GCW4 | 26-128 | None |
| A0A445N1M1 | 5-86 | None |
| A0A2E8Q544 | 183-291 | None |
| A0A1N6KPC8 | 272-424 | None |
| A0A7W2YJR8 | 240-361 | None |
| A0A7C3NR44 | 35-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.