DPCstruct | MC17375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5Z698 | 157-273 | WSVVAAAEDAVTKLVAVGMSRVNARILASRGITPETLEDFLNPQLRNLMPDPNTFIDMDKAVTRIAQAIRDGQRIGIWSDYDADGAT… |
| A0A448M591 | 8-121 | LPQTLIDTKAAQWKKNRLLTTLLLNRGFEDEKKADEFISPKISDFRDPFKFEKMEKVVDKILEKREKKEKVFIYGDYDVDGITAAVF… |
| A0A1Q7KGY9 | 17-126 | None |
| A0A382DK56 | 2-103 | None |
| A0A7C2PSS9 | 351-472 | None |
| A0A5D0MEC3 | 15-126 | None |
| A0A1V4M5I1 | 93-197 | None |
| A0A7T9HLT4 | 1-96 | None |
| A0A1V4QF21 | 3-128 | None |
| Q9ZIY3 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.