DPCstruct | MC17372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 260 ± 34 aa |
| Standard deviation of domain lengths | 34.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6VRK4 | 79-330 | QVEALDKAGKELPTPLAYRFARYESTADPDKKLLEGLLAVEEILRFGSIIGLSSTEPVPLRGINRQQISSLSMGTWLDLCIALANIP… |
| A0A4Y9N4H5 | 2-255 | ARTVRALQAAPTAKEQYESLLEVADALSISAGAVAAAWLRSVDPAIEGLTSLRRAYDRGVTQGSWHDVLRAAAQRAVDTPDAVPGLS… |
| A0A800J8N2 | 484-742 | None |
| A0A2U0UDX8 | 188-480 | None |
| A0A661PDG8 | 417-694 | None |
| A0A6B9ZP49 | 323-619 | None |
| D0LH94 | 15-293 | None |
| A0A150SKL4 | 13-183 | None |
| A0A418VJT2 | 3-232 | None |
| A0A2D0N0W3 | 211-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.