DPCstruct | MC17371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 11 aa |
| Standard deviation of domain lengths | 11.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 28.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M6YCY6 | 3-59 | LLFKIELWSADQNRVEELLGELGGYTLAKAAFDAAEDLYPGKPITIRQGARIIQKTD |
| A0A1H1KNB5 | 31-94 | AILASALPRPYEVEIWNGESGGIDELVATTGDLDVGRAAFTATVAKYPGRRITLRQRARVLIDS |
| A0A433XKC0 | 79-142 | None |
| A0A328ALY5 | 1-78 | None |
| A0A1I7NKE8 | 1-95 | None |
| A0A1H4UQL5 | 32-93 | None |
| A0A5S9NZ81 | 71-129 | None |
| A0A1Q3V539 | 2-69 | None |
| X6FN66 | 13-92 | None |
| A0A1G4UQE4 | 54-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.