DPCstruct | MC17370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 120 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M6Y7S0 | 1-124 | MSKGIKATLITKGGLGNVVVKHVWLLRHSREKWAQYNSAVKISYVRKGARKARGMVYSYAPYVILIDGWQDIPSQAIFGASKPGNTP… |
| A0A4Q2LIP4 | 87-198 | QEERKVTIVKLSEFGFPVAFQTVIKKVVVKPYAQYSESLRILHRPKRKRSNYENIILPDESILVYDGWINVDIDSTKNITESKHFII… |
| A0A5C7UL58 | 59-168 | None |
| A0A0D7WSW9 | 72-192 | None |
| A0A7C2JBI9 | 1-120 | None |
| A0A2V4VVX8 | 101-220 | None |
| A0A538QY70 | 1-127 | None |
| A0A7Y5U9G1 | 67-192 | None |
| E9RTE4 | 78-194 | None |
| A0A3M8B9L5 | 160-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.