DPCstruct | MC1737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0319 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5IU02 | 24-90 | NDHVYKIIEIVGSSTQSSDHAIQQAVAKAGTSLRNLDWFEVVETRGHIVDGKVAHYQVKLKIGFRLD |
| A0A6P1R7B3 | 167-245 | FLLHTEREDDMPESVYKVIELIGTSNDSWEKAAANAVEQAAKSLRDLRVAEVVKLDIQLDAKGKVEAYRAKLNVSFKFE |
| A0A521VC41 | 1-66 | None |
| A0A537YKJ3 | 1-75 | None |
| A0A6B1B5F4 | 3-75 | None |
| A0A081G4L6 | 39-111 | None |
| A0A5B9WEI4 | 34-107 | None |
| A0A2N5KLV3 | 2-70 | None |
| A0A3E0Q6J4 | 63-134 | None |
| A0A7J9T8N7 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.