DPCstruct | MC17365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9YZZ2 | 400-513 | VGRPQPSPGQMVPGVATPGKATVWQSENDVPLRRKMIAKIVSLLQQRKPDAPAEWIRRLPDMARRLEDSLYRTASGREVYGNFATLK… |
| A0A7S4V6P6 | 11-118 | WGNMQVRLTRPKNTAHRGLNGGWQSDWDVEERRRMIATIVHLLRERKPNAPQAWLDKLPQMAKRLEELLYRSAPSFDSYNDVNTLKQ… |
| A0A6D2I7H8 | 1-110 | None |
| K0QZC1 | 56-169 | None |
| A0A7S2EL62 | 1-108 | None |
| A0A7S1D4F4 | 17-127 | None |
| A0A067BXC8 | 386-519 | None |
| F0W7H6 | 1-114 | None |
| A0A7S2KDK8 | 1-144 | None |
| A0A6S8EE49 | 7-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.