DPCstruct | MC17364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 319 ± 78 aa |
| Standard deviation of domain lengths | 78.17 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8Q481 | 2-244 | ETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAG… |
| A0A7S4UQU0 | 82-420 | PYMLFKDHCNRKSNQKNLGTIKSSNLCTEIVEYTAPDEIAVCNLASINLSKFATPASDYSGETGNFDLNKLKEISEVVTRNLNRVID… |
| A0A4S4D7N4 | 1-226 | None |
| A0A8A3LUK8 | 412-811 | None |
| A0A3Q0JD53 | 161-564 | None |
| A0A378MVZ0 | 43-289 | None |
| A0A662QH30 | 331-652 | None |
| A0A0G1HTF2 | 2-297 | None |
| A0A1V6B3Z0 | 75-487 | None |
| A0A1F9H5F3 | 325-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.