DPCstruct | MC17363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 95 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0YMD5 | 4-79 | LDLTRAGINFLAIDFDLTLVDTHTEGRWPGSPSELAARVRPNLRHLMNEAMDAGIHVAIVTLSPQVPLISAVLQLI |
| A0A7S4UPU6 | 5-96 | RMSDEALLSQCEEAVTRLIELKINFLAIDFDQTIVDVHTHGQWKGSAHELSTHVRPLFQHLIPAAITADIKVAVVTFSPQCGQIKDV… |
| A0A024UXU6 | 44-147 | None |
| D7G4T3 | 3-86 | None |
| A0A815GPE4 | 26-141 | None |
| A0A6G0XHC8 | 9-121 | None |
| A0A816VSL3 | 279-392 | None |
| T1F0B4 | 2-102 | None |
| A0A2R5GNE9 | 672-759 | None |
| A0A7S1BZL6 | 20-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.