DPCstruct | MC17360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 322 |
|---|---|
| Mean domain length (aa) | 127 ± 23 aa |
| Standard deviation of domain lengths | 22.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 99.27 |
| Assigned Pfam label(s) | CL0123- CL0020- PF03457- PF00719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565CFS6 | 13-143 | DFLKKAYEMVDDPSTDSIVSWSPNGMAFIVWLPEECMRDILPKYLQVTTFSRFEYYGFRRLVAGKEEWVFDCDGFVRGKPELLDKIC… |
| A0A7S4SY54 | 2-118 | TFPYDTHDLINRCNEDAPSVAAWSDDGLHFTIKDKTTFEKDFLTTKYTTFTRRLHNYGFRKINSELEASGKTLLKDEEHFKHISFKR… |
| A0A3B4AHC2 | 1-149 | None |
| A0A2G3BHN4 | 2-138 | None |
| A0A2G5UK91 | 373-502 | None |
| A0A443N556 | 167-314 | None |
| A0A0C2XQE7 | 117-237 | None |
| A0A0C2XBT8 | 111-227 | None |
| A0A1J6IKK0 | 68-221 | None |
| B0EBV0 | 3-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.