DPCstruct | MC1736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 147 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A806TLK0 | 150-302 | TELTKQLKEANDQVAKAKDEVKTANAKAEEAKAETEKALAKAKETPAPAKEEPVKEEPKKETASSGSFHNPVLDLNPTNVASTIKSN… |
| A0A443T435 | 13-159 | FIIAVVVIVVVGGKNKKEEATTAPAEPKKEIKQEQSKQDIQAQPEKKEQLKQDVQQSASVFTNPIKNIDKTAAMNAVKEKAKKDFPD… |
| A0A7S9L033 | 28-156 | None |
| C3DG36 | 5-140 | None |
| A0A1H9S690 | 60-178 | None |
| A0A2M8YXT5 | 6-184 | None |
| A0A6D1SVE9 | 67-208 | None |
| A0A2W4W997 | 46-175 | None |
| A0A061PBZ6 | 1-219 | None |
| A0A5C7FE79 | 94-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.