DPCstruct | MC17358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9B8U4 | 51-119 | PVTVPTDASVDDFLAAVADERRRADALRLCAILRDVTGEPPVMWGPSIVGFGSYHGPTGDWPLAGFSPR |
| A0A161R0Z5 | 11-79 | NSVIEFIESVENLKKRENAYQLLDIFTETTGYTAKMWGPSIIGFGTYHYKYASGHEVDAPLVGFSPRKA |
| A0A349LRX8 | 2-76 | None |
| A0A0E3X1J3 | 2-67 | None |
| A0A143YJ34 | 1-78 | None |
| A0A847D4T7 | 3-80 | None |
| A0A4R8V3W3 | 26-106 | None |
| A0A480AP33 | 1-70 | None |
| B8CPM5 | 39-125 | None |
| A0A2A5WUR7 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.