DPCstruct | MC17356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 190 ± 51 aa |
| Standard deviation of domain lengths | 51.41 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 71.72 |
| Assigned Pfam label(s) | CL0111- CL0264- CL0492- CL0072- PF04487 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7M9C4 | 75-318 | PKKHLKRINAPKSWMLNKLGGIWATRPSQGPHKLRESLPLSVLLKERLNYALNGRDVTLILNDKEQNVFVDGKVRRDKGYPTGLMDV… |
| A0A7J2I2R1 | 6-201 | NAGKHSIRDSVPLGYFLKYLGFANTTREAKKLLLLTDVLIDGRKVKDVKCPVGFMDSIVVGQKAFRCLFGNKGRIIFIEVNDSDKKI… |
| A0A226NAC6 | 1-138 | None |
| A0A3M0JB68 | 349-595 | None |
| A0A2G5DC30 | 68-286 | None |
| A0A2R6FHV0 | 16-249 | None |
| A0A0B2NY19 | 2-116 | None |
| A0A1Q9E4M4 | 4-146 | None |
| A0A1E4SSI4 | 19-263 | None |
| A0A4Y7LAX9 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.