DPCstruct | MC17350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1345 |
|---|---|
| Mean domain length (aa) | 423 ± 103 aa |
| Standard deviation of domain lengths | 102.53 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.74 |
| Pfam Score | 32.90 |
| Assigned Pfam label(s) | CL0110- PF14291- PF12017- PF06507- PF10683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1RNE8 | 20-248 | PENIGAYISIDETAFSNGDLYTILTNKKAKGKKGALVLMVKGTKAETVTKILHKIPLKQRKKVKEVTLDMAGNMGLIVKKSFPSATL… |
| A0A6A4JER2 | 61-495 | SNNLKRAGMQSKIEDFSIKKLTPAAKKNIDGALLNMFTRDYQPFSVVEDKGFKKFVKTLNPSYTLPSRKKISSTLIPSRYEEIKLEL… |
| A0A815FTQ9 | 72-352 | None |
| A0A3P8N8K8 | 21-327 | None |
| W4H349 | 71-356 | None |
| W4GG46 | 2-288 | None |
| Q27395 | 33-540 | None |
| A0A5A9N9P4 | 2-344 | None |
| A0A4C1UKY6 | 17-398 | None |
| A0A4C1UCM7 | 479-834 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.