DPCstruct | MC1735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 235 ± 25 aa |
| Standard deviation of domain lengths | 24.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 73.61 |
| Assigned Pfam label(s) | PF01821- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817MTR2 | 34-266 | FRDNAEECCETGRIQAETNKTCTLKSHLITTDNDTNTTNYCPYLTHICCLSNVRKYFCEEGINTALRLLPCNETKLQLKDTYKICCR… |
| A0A4Y2KVK9 | 1-220 | METKVFFVALGALTLAFSQTTRADLEPVLTRCCSSGEVWARNHTTCTGPGEAAKLPPQDRLTCLTALYICCVRTHRQIYCENGKNAA… |
| G1T0Q0 | 2-188 | None |
| A0A085M9A4 | 2-254 | None |
| A0A8B6CSP4 | 558-826 | None |
| A0A3B1K3Q0 | 613-862 | None |
| V3ZWA7 | 2-199 | None |
| E9ISM2 | 2-244 | None |
| A0A5S6R2B7 | 67-304 | None |
| A0A158Q686 | 7-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.