DPCstruct | MC17347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821YEK5 | 6-109 | LANERLRILEDIEREIATILLNAGNVILELSKEKPNERLLDRHASQFTTSMQKVESELSGQIRYLTQVATGQPHEGSSYSARKDGTM… |
| A0A6A4J705 | 15-128 | APMEKIQILDSIEKDIVTCLHSAGTALVEFSKEKSSLKQAESQTHLFLKTLGQVESKLTEQINYLTQVSTGQPHEGSGYASQKVLQM… |
| A0A1A9V9H0 | 3-95 | None |
| G4LWF9 | 11-113 | None |
| A0A4Y7NJS8 | 62-171 | None |
| A0A2G8L759 | 2-106 | None |
| T1GBN9 | 6-98 | None |
| A0A3P9KR65 | 1-109 | None |
| A0A0G2H8K4 | 3-171 | None |
| A0A0N4UYT9 | 14-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.