DPCstruct | MC17345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 219 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4ISN6 | 4-214 | RGTVSENKLNRIRTDIQTECNKTILITVQEVEVFYRELGNIIDHTNAQVILTGLSRNMANFSLRLRLTVDQAIKGGMTSYWSIHAAF… |
| A0A016SBX6 | 15-245 | LSPVAMLTYAFVALAKRGTISDDFCTQIIEGIRQEVGFVITMSSEVIKYLRTYYGDVMDDLVSDTLFAHWKNELPANTLRLRITLEQ… |
| A0A6A4KEC8 | 491-696 | None |
| A0A6A4KED9 | 766-991 | None |
| A0A6A4J651 | 72-287 | None |
| A0A6A4K8E9 | 285-491 | None |
| A0A834FEQ0 | 174-404 | None |
| A0A6A4JV87 | 21-238 | None |
| A0A0N4YI91 | 234-479 | None |
| A0A077Z104 | 61-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.