DPCstruct | MC17341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 164 ± 26 aa |
| Standard deviation of domain lengths | 26.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.66 |
| Pfam Score | 91.98 |
| Assigned Pfam label(s) | CL0126- PF15309- PF17730- PF01562- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3NWU4 | 64-217 | YPSREAPVYEGIEFDKNSLRFSEIFSDFDTVTANPDAFRKAAEDGTIELYLRGRAFELEFDVAETFTPKVIMENESGFYTEETAPIS… |
| A0A2G8K3E4 | 22-191 | DKLIQQFGHYELVVPSLVNHRGDFLSYDIINSRKRTRRHLDTHKEPLADKTIHYSVQAYGTQFHMNLTLNTKLISPHFVVEREDRTG… |
| H3B578 | 1-127 | None |
| A0A5E4QDE8 | 32-188 | None |
| A0A6J3EK86 | 304-432 | None |
| A0A6I9PWJ2 | 3-162 | None |
| A0A2I3M3V3 | 26-186 | None |
| F7EP17 | 17-190 | None |
| A0A523EFS2 | 35-204 | None |
| A0A1I8IGK8 | 182-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.