DPCstruct | MC17340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 257 ± 50 aa |
| Standard deviation of domain lengths | 49.78 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8K210 | 101-351 | ISDRFDTEITPAGWTFSIWGVIYIFQALWIIYILISICRRTESGPLYKNPMIVSVLFLAVYALNMALNVSWLLLWDRLMFEVALAVL… |
| A0A6S6P2S2 | 14-224 | ATNQALITPAGYAFSLWGLITLLSTVTAVAVVRHGLGSSWETDALIDASVVFVGFSVWLVVAAQDWLWASVVVFVVMAVALAHIMWL… |
| B7FPJ2 | 15-307 | None |
| A0A3Q3WDR8 | 27-186 | None |
| A0A484C0T9 | 204-522 | None |
| A0A814NHM9 | 28-309 | None |
| A0A5C6NYA2 | 11-304 | None |
| A0A4Y9Y2S0 | 16-282 | None |
| A0A0C3CGK7 | 4-288 | None |
| A0A7T9I2W8 | 3-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.