DPCstruct | MC1734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 350 ± 42 aa |
| Standard deviation of domain lengths | 41.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C2D0 | 19-292 | LKKGNKRKQQKVLNELRRETKVLEAVDDIRNDKKNRRIAFQGVKRQMTLWKGPVMRNRLSDQLIFPLNDTSVTLINSEESQLMRAKD… |
| A0A4Y2KPR5 | 1-367 | MAAQRSEASLNVSEFDLNEVGKETIKLNELIKTSQKLSGAGSVKKQLEKVKKLQSLSVPLSKPQMTKIKRTMGYTKVCDELKRWEPV… |
| V4A7N2 | 61-434 | None |
| A0A0B2UW12 | 25-400 | None |
| B7PRV8 | 1-348 | None |
| A0A6B0RMW8 | 16-295 | None |
| A0A0R3QXZ2 | 281-652 | None |
| A0A5N5K4Y8 | 63-426 | None |
| A0A1D6K2M6 | 139-455 | None |
| A0A401T6F7 | 69-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.