DPCstruct | MC17338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 212 ± 24 aa |
| Standard deviation of domain lengths | 23.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EWR0 | 55-281 | RGFMSWDELGCLARAVGFPTDLFKSNLTKHVTAEDHGMNVEQVHKMLDLRLLQKSIHRTRNLHTGEWNTKVIRKALFLMDHHALTFE… |
| A0A2G8K087 | 2-240 | SGITAGCLSRALGFHPRVITECIPSDLVRKEDGISHRELMKLINLKFFNDALDRSANMHTADYNINVLKKKHRSSQPQTPECKSLGM… |
| A0A814PVN0 | 4-206 | None |
| A0A7M5XM67 | 25-215 | None |
| V3ZQX0 | 16-246 | None |
| A0A2P6N7J0 | 5-221 | None |
| H2YL91 | 1-242 | None |
| A0A7I8WDI0 | 5-241 | None |
| A0A7J7JZ00 | 19-194 | None |
| A0A433TX26 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.