DPCstruct | MC17336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 230 |
|---|---|
| Mean domain length (aa) | 183 ± 40 aa |
| Standard deviation of domain lengths | 39.64 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.05 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | CL0128- CL0254- CL0084- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8JWC1 | 3-168 | DTSLSKTLSFVLRHKAPELGFTILPGGYIPVDEILAHHMFRRYSKDDIVRVVNQNQKKRFDMKVDPGRGDLIAANQGHSFLGLKKMN… |
| T0LAI4 | 22-205 | LSEEEVDMLGRIITGILRHKPEKYHLEISDRGYVNIDEMVQEIRFYYRRFHFVGPSHIFAIILTDQKGRYQLSDNKRYLRATYGHSI… |
| A0A812LM15 | 25-280 | None |
| A0A813F8H1 | 322-464 | None |
| A0A4V1XL76 | 56-226 | None |
| A0A556TNJ5 | 1-115 | None |
| A0A7J7MCD3 | 548-751 | None |
| A0A1Q9ELR7 | 369-584 | None |
| A0A4S2AWN4 | 6-170 | None |
| A0A1Q9E516 | 310-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.