DPCstruct | MC17335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 401 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 96.92 |
| Assigned Pfam label(s) | CL0023- CL0213- CL0126- CL0550- CL0168 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674F7F5 | 70-172 | YSCVQEHETISSIICEGSDSQLLCDRGEIHIQRANYGRRQHDVCSIGRPDNQLKNTNCLSQSSTSTMSERCDGERQCIVKVSNSVFG… |
| A0A2G8JVD4 | 164-287 | CSFPVVKLPTKSLVCEGDDYVISCKVNQTIKIIYASYGFQYNDSEARDQCDDFRNSLFLNLDGVRCDPNSTLKASAVCNGLMACTIS… |
| A0A6P8HGT5 | 524-622 | None |
| A0A6P8HSC4 | 27-134 | None |
| A0A6P8IAK3 | 1111-1221 | None |
| A0A069DN36 | 19-130 | None |
| A0A1I8HY42 | 99-212 | None |
| A0A6P4EYU9 | 14-130 | None |
| A0A069DV34 | 183-279 | None |
| A0A7M5V162 | 21-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.