DPCstruct | MC1733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2FY74 | 56-160 | KDIVHRSDEWNVRVIDKGVKNCWSWNWLEKQIDGVYVREISRKIVKAGIVYGSICYKDLQYDKHGFAVLARHMNSSKHTSNVKARKD… |
| A0A4Y2KKQ2 | 1-86 | MASVRTDIVSRSSSADVRELDKQAQNLWRREWLEKQSEGIYLREIIRKSNKCGACYCIVCSRELAYGSRGFVALTDHVKSIMHKSF |
| A0A4Y2IRR9 | 40-150 | None |
| A0A4Y2LEG1 | 299-397 | None |
| A0A4Y2LAN2 | 279-381 | None |
| A0A4Y2P4F3 | 1-97 | None |
| A0A4Y2DJ48 | 1-97 | None |
| R7VLT7 | 194-289 | None |
| A0A4Y2K574 | 3-108 | None |
| A0A2T7P4L7 | 3-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.