DPCstruct | MC17329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 296 ± 43 aa |
| Standard deviation of domain lengths | 42.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8JKJ3 | 23-331 | SDSSSSSSYSSSGESSSEDSEEEVRITVKKPKLDSATKKQKRKEQKRQEKKNKMKATNKISKDDYYSKNVEFRLWLMEEKKLAMGDM… |
| A0A7S2KR39 | 81-385 | LKRAKEFVQEEEEKKRSSSKRSKKLKSRHDSKKRAHVPKLDLGPKRDTPPEVMLNEETDYFRYHDHLRIYLATKGLTFENLSSEESR… |
| A0A2G8SBW2 | 166-457 | None |
| B8C048 | 173-468 | None |
| A0A446BWG7 | 24-346 | None |
| A9UTS6 | 16-251 | None |
| B2CJ82 | 16-329 | None |
| A0A232LPX4 | 384-748 | None |
| M3CE59 | 12-290 | None |
| A0A423VY99 | 41-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.