DPCstruct | MC17327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 143 ± 13 aa |
| Standard deviation of domain lengths | 13.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8JK69 | 1-123 | MVRFYHKLFCEWYAAHHLVTLVKNACDINETLRFLDPFDLQYLFRFACGLDPDAGKKLINHLKSLPGGDTFAILCILEQTGDVSEIM… |
| A0A2G8JIC2 | 2-159 | LAQEVVFDIPKGRYKTVARISHKIICEFYASHHLVWILSEGASSAASPINVKETLKSINPLDLQYVYRFACGLNKSAADIIIKYLQK… |
| A0A2G8K2S4 | 4-121 | None |
| A0A2G8K3V6 | 726-884 | None |
| A0A2G8L084 | 59-207 | None |
| A0A2G8L2T8 | 17-162 | None |
| A0A2G8L5H2 | 369-515 | None |
| A0A2G8LF06 | 97-245 | None |
| A0A2G8LEQ2 | 243-389 | None |
| A0A2G8LF99 | 2-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.